LC-MS is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Last reviewed on 2025-11-24. Where a claim depends on a specific study, the study is described rather than over-claimed.
Melanotan-2 is a synthetic cyclic heptapeptide designed as an analogue of alpha-melanocyte-stimulating hormone. Its sequence incorporates a lactam bridge that constrains the peptide into a ring, which increases resistance to enzymatic breakdown relative to the natural hormone. Researchers at the University of Arizona synthesised the compound in the late 1980s and early 1990s while studying pigmentation pathways. It has never received marketing approval from any national medicines regulator. In the scientific literature it is usually described as a laboratory research reagent rather than a therapeutic product.
The peptide acts as a non-selective agonist at melanocortin receptors, showing affinity for MC1R, MC3R, MC4R and MC5R. Activation of MC1R on melanocytes drives the conversion of tyrosine into melanin and shifts production toward the darker eumelanin form. MC4R signalling in the central nervous system is linked to appetite and energy balance, which helps explain why reduced food intake appeared in early human studies. Effects on MC4R and on vascular tone also account for the erectile responses recorded as unexpected findings in those same trials.
Melanotan-2 is frequently confused with afamelanotide, a linear analogue authorised in the European Union for erythropoietic protoporphyria. The two compounds differ in chain length, ring structure and receptor selectivity, so findings for one cannot be transferred directly to the other. Published controlled human data on melanotan-2 remain sparse, and much of what circulates online derives from small studies or unpublished reports. Questions about effect size, dose-response behaviour and long-term safety therefore remain unresolved.
Reversed-phase high-performance liquid chromatography is the routine method for purity assessment. Peptides absorb near 214 nm because of the peptide bond, and a gradient of acetonitrile in water separates the intact peptide from deletion sequences, oxidised products, and earlier-eluting fragments at neutral pH. Electrospray ionisation mass spectrometry provides an orthogonal check: the measured mass must agree with the theoretical value. Amino acid analysis and peptide mapping confirm structure but are used less often. Reference standards remain scarce because the peptide is not described in any pharmacopoeia.
Regulatory treatment varies by country. In the United States the peptide is not approved as a medicine, and products offered for human use may be treated as unapproved new drugs; some states also restrict sale. Australia, the United Kingdom, and European Union member states apply comparable restrictions to unapproved peptide products. Border agencies have seized shipments labelled as research chemicals. Classification may change over time, and the legal position for personal importation is not clearly settled in most published guidance.
| Property | Value | Notes |
|---|---|---|
| Chemical class | Synthetic cyclic heptapeptide | Alpha-MSH analogue with a lactam ring |
| Molecular formula | C50H69N15O9 | Commonly cited value for the neutral peptide |
| Molecular weight | 1024.18 g/mol | Calculated for the free molecule |
| Appearance | White to off-white powder | Typically supplied as a lyophilised solid |
| Solubility | Soluble in water, DMSO and ethanol | Dissolution in pure water is often slow |
No regulatory authority has approved melanotan-2 for human use, and several countries classify it as a prescription-only or controlled substance, which restricts lawful supply. Material sold online is generally labelled as a research chemical and is not required to meet pharmaceutical standards of identity or purity. Published human data consist mainly of small uncontrolled studies, case reports and adverse-event notifications, so the evidence base is descriptive rather than confirmatory. Whether repeated melanocyte stimulation alters long-term naevus behaviour remains an open question that no completed trial has resolved.
Melanotan-2 is a synthetic cyclic heptapeptide designed as a structural analogue of alpha-melanocyte-stimulating hormone, the endogenous tridecapeptide that regulates pigment production. Two modifications distinguish it from the natural hormone: norleucine replaces methionine at the N-terminus, which limits oxidation, and a D-phenylalanine substitution raises receptor affinity. The ring is closed through an aspartate-lysine lactam bridge, giving the molecule a constrained conformation. The free base has a molecular mass near 1024 daltons, and commercial material is usually supplied as an acetate salt. It appears in the literature as a research peptide rather than an approved therapeutic agent.
Receptor studies place melanotan-2 among non-selective melanocortin agonists, binding MC1R, MC3R, MC4R and MC5R rather than a single subtype. Activation of MC1R on cutaneous melanocytes raises tyrosinase activity and shifts pigment synthesis toward eumelanin, which is darker and more photostable than pheomelanin. Central receptors, particularly MC4R, are associated with appetite suppression and with reported effects on sexual function. Because subtype selectivity is low, the same molecule engages pigment, metabolic and vascular pathways at once, and this breadth is a common explanation offered for the range of adverse events described in user reports.
Verification of a purchased sample requires documentation linking a batch to a certificate of analysis, and that document should be read for the methods used rather than the headline purity figure. A single chromatographic percentage does not establish identity. Independent laboratories can perform identity and content assays, but no such test establishes that a product is suitable for human use. Claims about efficacy rest largely on small, early studies rather than on replicated controlled trials, and that gap remains open.
Identity testing for a cyclic peptide of this size usually relies on reversed-phase high-performance liquid chromatography coupled to mass spectrometry. The mass spectrum confirms molecular weight, while the chromatographic trace indicates the proportion of related impurities. Tandem mass spectrometry can provide sequence-level information when fragmentation data are compared against a reference standard. Nuclear magnetic resonance is sometimes used to confirm the lactam bridge, although it requires more material and greater operator expertise than routine chromatographic methods.
The peptide was developed during the 1980s by researchers investigating melanocortin signalling and skin pigmentation pathways. Early work focused on analogues of alpha-melanocyte-stimulating hormone that would resist enzymatic breakdown more effectively than the parent molecule. Melanotan-2 emerged from that programme as a shortened, cyclised variant. Reports describing its synthesis and receptor activity later appeared in the scientific literature. Commercial availability grew through unregulated channels rather than through pharmaceutical approval.
Structurally, Melanotan-2 retains the core recognition motif of alpha-melanocyte-stimulating hormone while adding a lactam bridge that links two side chains and constrains the molecule into a ring. This modification lowers susceptibility to enzymatic degradation. The compound acts as an agonist at melanocortin receptors, particularly subtypes associated with melanin production. Because the same receptor family influences several physiological processes, researchers note that its activity is not confined to pigmentation alone. Receptor selectivity continues to be examined in published studies.
Melanotan-2 is a synthetic cyclic heptapeptide designed as an analogue of alpha-melanocyte-stimulating hormone, a naturally occurring peptide involved in pigmentation signalling. Its sequence incorporates modified residues that increase potency and extend biological activity relative to the native hormone. The compound binds receptors of the melanocortin family and is examined mainly in laboratory research. It does not occur naturally and exists only as a manufactured chemical entity produced by solid-phase synthesis.
=== Domestic use === When a sanitary potable water supply is plumbed to an unsanitary system, for example lawn sprinklers, a dish washer or a washing machine, a check valve called a backflow preventer is used to prevent contaminated water from re-entering the domestic water supply. Some types of irrigation sprinklers and drip irrigation emitters have small check valves built into them to keep the lines from draining when the system is shut off. Check valves used in domestic heating systems to prevent vertical convection, especially in combination with solar thermal installations, also are called gravity brakes. Rainwater harvesting systems that are plumbed into the main water supply of a utility provider may be required to have one or more check valves fitted to prevent contamination of the primary supply by rainwater. Hydraulic jacks use ball check valves to build pressure on the lifting side of the jack. Check valves are commonly used in inflatables, such as toys, mattresses and boats. This allows the object to be inflated without continuous or uninterrupted air pressure.
== Synthesis == ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Enzyme catalysis is the increase in the rate of a process by an "enzyme", a biological molecule. Most enzymes are proteins, and most such processes are chemical reactions. Within the enzyme, generally catalysis occurs at a localized site, called the active site. Most enzymes are made predominantly of proteins, either a single protein chain or many such chains in a multi-subunit complex. Enzymes often also incorporate non-protein components, such as metal ions or specialized organic molecules known as cofactor (e.g. adenosine triphosphate). Many cofactors are vitamins, and their role as vitamins is directly linked to their use in the catalysis of biological process within metabolism. Catalysis of biochemical reactions in the cell is vital since many but not all metabolically essential reactions have very low rates when uncatalysed. One driver of protein evolution is the optimization of such catalytic activities, although only the most crucial enzymes operate near catalytic efficiency limits, and many enzymes are far from optimal. Important factors in enzyme catalysis include general acid and base catalysis, orbital steering, entropic restriction, orientation effects (i.e. lock and key catalysis), as well as motional effects involving protein dynamics Mechanisms of enzyme catalysis vary, but are all similar in principle to other types of chemical catalysis in that the crucial factor is a reduction of energy barrier(s) separating the reactants (or substrates) from the products.
The LCD panel is designed for medical equipment and professional video equipment. On October 25, 2012, LG Electronics began selling the first flat panel Ultra HD display in the United States with a resolution of 3840 × 2160. The LG 84LM9600 is an 84 in (210 cm) flat panel LED-backlit LCD with a price of US$19,999 though the retail store was selling it for US$16,999. On November 29, 2012, Sony announced the 4K Ultra HD Video Player—a hard disk server preloaded with ten 4K movies and several 4K video clips that they planned to include with the Sony XBR-84X900. The preloaded 4K movies are The Amazing Spider-Man, Total Recall (2012), The Karate Kid (2010), Salt, Battle: Los Angeles, The Other Guys, Bad Teacher, That's My Boy, Taxi Driver, and The Bridge on the River Kwai. Additional 4K movies and 4K video clips will be offered for the 4K Ultra HD Video Player in the future. On November 30, 2012, Red Digital Cinema Camera Company announced that they were taking pre-orders for the US$1,450 REDRAY 4K Cinema Player, which can output 4K resolution to a single 4K display or to four 1080p displays arranged in any configuration via four HDMI 1.4 connections. Video output can be DCI 4K (4096 × 2160), 4K Ultra HD, 1080p, and 720p at frame rates of up to 60 fps with a color depth of up to 12 bpc with 4:2:2 chroma subsampling. Audio output can be up to 7.1 channels. Content is distributed online using the ODEMAX video service. External storage can be connected using eSATA, Ethernet, USB, or a Secure Digital memory card.
Sources: en.wikipedia.org
=== Psychosocial factors === Empirical studies have established a strong correlation between adverse childhood experiences such as child abuse, particularly child sexual abuse, and the onset of BPD later in life. Reports from individuals diagnosed with BPD frequently include narratives of extensive abuse and neglect during early childhood, though causality remains a subject of ongoing investigation. These individuals are significantly more prone to recount experiences of verbal, emotional, physical, or sexual abuse by caregivers, alongside a notable frequency of incest and loss of caregivers in early childhood. Moreover, there have been consistent accounts of caregivers invalidating the individuals' emotions and thoughts, neglecting physical care, failing to provide the necessary protection, and exhibiting emotional withdrawal and inconsistency. Specifically, female individuals with BPD reporting past neglect or abuse by caregivers have a heightened likelihood of encountering sexual abuse from individuals outside their immediate family circle. Research also indicates that neurodevelopment variations such as autism spectrum traits, ADHD, or highly sensitive people (HSP) may increase vulnerability to trauma and subsequent borderline personality organization. The enduring impact of chronic maltreatment and difficulties in forming secure attachments during childhood has been hypothesized to potentially contribute to the development of BPD.
=== Nutrition === Raw chanterelle mushrooms are 90% water, 7% carbohydrates, including 4% dietary fiber, 1.5% protein, and have negligible fat. A 100 gram reference amount of raw chanterelles supplies 38 kilocalories of food energy and the B vitamins, niacin and pantothenic acid, in rich content (20% or more of the Daily Value, DV), 27% DV of iron, with moderate contents (10-1 of riboflavin, manganese, and potassium (table). When exposed to sunlight, raw chanterelles produce a rich amount of vitamin D2 (35% DV) – also known as ergocalciferol.
=== Snakes === Paracetamol is lethal to snakes and has been suggested as a chemical control program for the invasive brown tree snake (Boiga irregularis) in Guam. Doses of 80 mg are inserted into dead mice that are scattered by helicopter as lethal bait to be consumed by the snakes.
== Experiments with argiotoxins == Argiotoxins studies have been particularly made to discover the relation between inhibition, receptors, and ionic channels. Researchers have specifically pursued the blocking of receptors on invertebrates, rather than on vertebrates. Referring to invertebrates, Planorbarius corneus is a mollusc involved in one of the many ionic experiments. To begin with, neurons of molluscan pedal ganglia were isolated and transferred to a special chamber with saline solution and regulated temperature. Then, the observation was based on routine voltage clamp technique. Electrical measurements were obtained from the evaluation of neurons response to various substances (argiopines). In addition to that, crayfish, a freshwater crustacean, has followed a similar protocol to this study. In this case, the analysis was made of the stomach muscles and using the patch clamp technique. The research findings were obtained taking into account the bursts of openings of excitatory channels. Other experiments use spectroscopy in order to analyse and differentiate these molecules. HPLC, mass spectrometry, UV data and amino acid analysis are the elements that allow identifying diverse argiotoxins due to their spectrum. Argiope lobata toxins (Arg 636, Arg 630, Arg 658, Arg 744, Arg 759, Arg 373, Arg 728, Arg 723, ...) show a close similarity in their structures; the subtle differences between them are chemical points, such as N-methyl groups, molecular masses or lysine residues that are determined in a certain position in their structure.
When founded in 1517, the city was named Franciscopolis after Francis I of France. It was subsequently named Le Havre-de-Grâce ("Harbor of Grace"; hence Havre de Grace, Maryland). Its construction was ordered to replace the ancient harbours of Honfleur and Harfleur whose utility had decreased due to silting. The history of the city is inextricably linked to its harbour. In the 18th century, as trade from the West Indies was added to that of France and Europe, Le Havre began to grow. On 19 November 1793, the city changed its name to Hâvre de Marat and later Hâvre-Marat in honor of the recently deceased Jean-Paul Marat, who was seen as a martyr of the French Revolution. By early 1795, however, Marat's memory had become somewhat tarnished, and on 13 January 1795, Hâvre-Marat changed its name once more to simply Le Havre, its modern name. During the 19th century, Le Havre became an industrial center. In the early 19th century it was the most important port for cotton, supplying France, Switzerland, and Germany with cotton imports. Jules Siegfried was member of a Le Havre cotton printers family. Jules Lecesne was a renowned Le Havre cotton importer. At the end of World War I Le Havre had a major role as the transit port used to wind up affairs after the war. The city was devastated during the Battle of Normandy when 5,000 people were killed and 12,000 homes were totally destroyed before its capture in Operation Astonia. Between 1945 and the 1960s, the center was extensively rebuilt to designs of a modernist style by Auguste Perret.
Sources: en.wikipedia.org
It is a synthetic cyclic heptapeptide modelled on alpha-melanocyte-stimulating hormone. A lactam bridge links two side chains, forming a ring that stabilises the molecule against proteolysis. It belongs to the broader melanocortin peptide family.
No national medicines agency has approved melanotan-2 for clinical use. Afamelanotide, a related but distinct peptide, holds a marketing authorisation in the European Union for a rare photosensitivity disorder. Melanotan-2 itself is handled as a laboratory chemical.
Its broad activity across melanocortin receptors makes it a tool for probing pigmentation, appetite and vascular signalling. Early trials recorded skin darkening and other effects that were not the original focus of the work. Those observations generated hypotheses that later studies have examined.
Low temperature slows hydrolysis and oxidation, the two main routes by which the peptide backbone and side chains are modified. A lyophilised powder stored at −20 °C is more stable than one kept at room temperature, and once the material is dissolved the degradation rate rises, making refrigeration more important.